PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g30550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 527aa    MW: 59425.6 Da    PI: 6.4158
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g30550genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.7e-103724091954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Tp5g30550 372 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 409
                665559******************************88 PP

2BELL125.91.5e-40235306172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglg+akpYts+Al++iSrhFrcL+dai+eqi
  Tp5g30550 235 ERQELQSKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVAGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 306
                79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.2E-53166304IPR006563POX domain
PfamPF075262.0E-48172302IPR006563POX domain
PROSITE profilePS5007112.422350413IPR001356Homeobox domain
SMARTSM003896.5E-10353417IPR001356Homeobox domain
CDDcd000867.88E-12353414No hitNo description
SuperFamilySSF466898.98E-18354421IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28356419IPR009057Homeodomain-like
PfamPF059206.5E-18370409IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MAVYYPTTVG MQSLYQESIY LNEQQQQASS SSAASFSDIV SGGGGGGGNC LEIPNSGGGV  60
RNEMVFIPPT SDDVVVTGLN GNVNGTVTVS NNDLSFHGGG LSLSLGNQIQ YHYQNLYNNQ  120
NPSLSDENGK SLSHHHQHHQ SEQIPIPSSG YSNGVGFYNN YRYETSGFVS SVLRSRYLKP  180
TQQLLDEIVS VRKDLKLGDS NKKSKNNDKS QDFTNGSSDN NTENEKLREE LSPSERQELQ  240
SKKSKLLTMV DEVDKRYNQY HHQMEALASS FEMVAGLGAA KPYTSVALNR ISRHFRCLRD  300
AIKEQIQVIR GKLGERESSE EQGERIPRLR YLDQRLRQQR ALHQQLGMVR PAWRPQRGLP  360
ENSVSILRAW LFEHFLHPYP KESEKIMLAK QTGLSKNQVA NWFINARVRL WKPMIEEMYK  420
EEFGDSSELV SNSNQDNKMQ ETSLLKQEDS SSSQQQNHGN NNVPYTSDAE ENLVFADPKP  480
DRATTGDYDS LMSYNGFGVD DYNRYIGLGN QQDGRFSNPH QLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16359417563Homeobox protein Meis2
3k2a_B3e-16359417563Homeobox protein Meis2
4xrm_A3e-16359417563Homeobox protein Meis2
4xrm_B3e-16359417563Homeobox protein Meis2
4xrs_A2e-16359416158Homeobox protein Meis1
4xrs_B2e-16359416158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390306.10.0hypothetical protein EUTSA_v10018381mg
RefseqXP_006390307.10.0hypothetical protein EUTSA_v10018381mg
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3